PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do016806.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 859aa    MW: 95793.3 Da    PI: 4.245
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do016806.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.1e-12769828463
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +r rr+++NRe+ArrsR RK++++ eL   v  L + N++L ++l++    ++++  e+
  Do016806.1 769 ERRKRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCDRVLHEN 828
                 6899*******************************************9999998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF578501.11E-18220272No hitNo description
Gene3DG3DSA:3.30.40.101.5E-17221270IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF136391.6E-11224266IPR001841Zinc finger, RING-type
CDDcd001621.03E-9224269No hitNo description
SMARTSM001841.7E-7225265IPR001841Zinc finger, RING-type
PROSITE profilePS5008911.899225266IPR001841Zinc finger, RING-type
SMARTSM009502.1E-4297744IPR003165Piwi domain
PfamPF021715.8E-19543736IPR003165Piwi domain
SuperFamilySSF530981.77E-15544733IPR012337Ribonuclease H-like domain
PROSITE profilePS5082215.192546738IPR003165Piwi domain
Gene3DG3DSA:3.30.420.106.6E-6549733IPR012337Ribonuclease H-like domain
SMARTSM003381.0E-14766830IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-9766822No hitNo description
PROSITE profilePS5021710.588768831IPR004827Basic-leucine zipper domain
PfamPF001703.0E-9768828IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11770819No hitNo description
CDDcd147021.48E-18771822No hitNo description
PROSITE patternPS000360773788IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MANDSLAHHL LRPLAAGCCS DDVDEYDEEE PANVAFPSFW PPFPALSSDS DSDAASFVRP  60
RMDRPREAAA SSFFGLGFHD GDDGEWAPPD EEDGEVELPL CWDCLQLEDH DEHQRWDVGV  120
SDADEWEQVA GREEEAASSA VRSLEWEVLL AANSLGSLAV DDDDELDAGI ETYFLDDADD  180
LLFGQLAAAG ADHEPPGKCG RPAAKAAVEA LPTVVVDAAS GDAQCAVCKD GVEAGERARR  240
LPCAHLYHDS CILPWLAIRN TCPLCRHELP TDDPEYEKWK ARRAAGGGGG GDADARGVAT  300
GIRERLLKIG WGTRVPYKKG SSVPYHEYSK LFDANGYYKL NGKRPEKVPE EAIAQKRSGL  360
YAAVHEERES STPCDTTPEK KKPDCKKWET SEMGEASEQR LLPVADDSTM MSEAVKYNTT  420
FDSLEEIRQD EDSETNSHVG SDEEIEEVDS CDEEIQEGEG SEQLEETEDD GSEQLDSSYQ  480
QGIDDRCDED LQEIEETEDD GSEQLDSSDQ QGMDDGCDED LPVLRHDAGF QQPVVRTAIP  540
FLLEASTLIF GGDIMSRSSP REGSISIASV VALMDWPGAN NYRALVSYQP HNEVIIKNFN  600
GLLNELICAF HQNTEKMPTR IIYLRNGVTE DQLGRTFGHE IDVIRMVCPQ AQITFVAVAQ  660
RISHEFLGSE IGEDCNLTKF FCSHVDEGSN TLVSYRVLHD DNHFTADKLH SLCIDLSTND  720
FLFQYSNLLV PHPSCYQDVA HLIHEASLPV GNKSNSEESD DYQRSLAEER RKRRMISNRE  780
SARRSRMRKQ KQLSELWAQV VHLRSTNRQL LDQLNHVIRD CDRVLHENSQ LRDEQTKLQK  840
QLEKLPVETT ESGVMCPNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4f3t_A3e-17540743586811Protein argonaute-2
4ola_A3e-17540743584809Protein argonaute-2
4olb_A3e-17540743584809Protein argonaute-2
4w5n_A3e-17540743584809Protein argonaute-2
4w5o_A3e-17540743584809Protein argonaute-2
4w5q_A3e-17540743584809Protein argonaute-2
4w5r_A3e-17540743584809Protein argonaute-2
4w5t_A3e-17540743584809Protein argonaute-2
4z4c_A3e-17540743584809Protein argonaute-2
4z4d_A3e-17540743584809Protein argonaute-2
4z4e_A3e-17540743584809Protein argonaute-2
4z4f_A3e-17540743584809Protein argonaute-2
4z4g_A3e-17540743584809Protein argonaute-2
4z4h_A3e-17540743584809Protein argonaute-2
4z4i_A3e-17540743584809Protein argonaute-2
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1769790RRKRRMISNRESARRSRMRKQK
2782789RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0378310.0BT037831.1 Zea mays full-length cDNA clone ZM_BFb0198I03 mRNA, complete cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-24basic leucine-zipper 42